Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA014307 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-S1PR2
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GSLYSEYLNPNKVQEHYNYTKETLETQETTSRQ
- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Critical role of sphingosine-1-phosphate receptor-2 in the disruption of cerebrovascular integrity in experimental stroke
Kim G, Yang L, Zhang G, Zhao H, Selim M, McCullough L, Kluk M, Sanchez T
Nature Communications 2015;6(1)
Nature Communications 2015;6(1)
No comments: Submit comment
No validations: Submit validation data