HPA021554

ZBTB10 antibody from Sigma-Aldrich
FLJ12752, RINZF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021554
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021554, RRID:AB_1858937
Product name
Anti-ZBTB10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021554
Antibody type
Polyclonal
Antigen
Zinc finger and BTB domain-containing protein 10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSWVQDGSPEMAENESEGQTKVFIWNNMGSQGIQE
TGKTRRKNQTTKRFIYNIPPNNETNLEDCSVMQPP
VAYPEENTLLIKEEPDLDGALLSGPD
Storage
-20C
Provider Type Product Number
- No reagents -