HPA002807

MFGE8 antibody from Sigma-Aldrich
BA46, EDIL1, hP47, HsT19888, MFG-E8, OAcGD3S, SED1, SPAG10
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002807
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002807, RRID:AB_1078072
Product name
Anti-MFGE8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002807
Antibody type
Polyclonal
Antigen
Lactadherin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLD
KQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQ
GARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGS
SKIFPGNWDNHSHKKNLFETPILARYVRILPVAWH
NRIALRLEL
Storage
-20C
Provider Type Product Number
- No reagents -