H00004909-M02

NTF4 antibody from Abnova Corporation
GLC1O, NT-4/5, NTF5

Antibody data

Product number
H00004909-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004909-M02, RRID:AB_1237801
Product name
NTF5 monoclonal antibody (M02), clone 1G12
Provider product page
Abnova Corporation - H00004909-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant NTF5.
Antigen sequence
MLPLPSCSLPILLLFLLPSVPIESQPPPSTLPPFL
APEWDLLSPRVVLSRGAPAGPPLLFLLEAGAFRES
AGAPANRSRRGVSETAPASRRGELAVCDAVSGWVT
DRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETR
CKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQS
YVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA
Isotype
IgG
Antibody clone number
1G12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -