HPA024652

MARK3 antibody from Atlas Antibodies
CTAK1, KP78, PAR-1A
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024652
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024652, RRID:AB_1853582
Product name
Anti-MARK3
Provider product page
Atlas Antibodies - HPA024652
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QSPHHKVQRSVSSSQKQRRYSDHAGPAIPSVVAYP
KRSQTSTADSDLKEDGISSRKSSGSAVGGKGIAPA
SPMLGNASNPNKADIPERKKSSTVPSSNTASGGMT
RRNTYVCSERTTADRHSVIQNGKENSTIPDQRTPV
ASTHSISSAA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -