HPA024652

MARK3 antibody from Sigma-Aldrich
CTAK1, KP78, PAR-1A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024652
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024652, RRID:AB_1853582
Product name
Anti-MARK3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024652
Antibody type
Polyclonal
Antigen
MAP/microtubule affinity-regulating kinase 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QSPHHKVQRSVSSSQKQRRYSDHAGPAIPSVVAYP
KRSQTSTADSDLKEDGISSRKSSGSAVGGKGIAPA
SPMLGNASNPNKADIPERKKSSTVPSSNTASGGMT
RRNTYVCSERTTADRHSVIQNGKENSTIPDQRTPV
ASTHSISSAA
Storage
-20C
Provider Type Product Number
- No reagents -