HPA001436

C6orf15 antibody from Sigma-Aldrich
STG
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001436
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001436, RRID:AB_2243752
Product name
Anti-C6orf15 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001436
Antibody type
Polyclonal
Antigen
Uncharacterized protein C6orf15 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PEDPWQMMAAAAEDRLGEALPEELSYLSSAAALAP
GSGPLPGESSPDATGLSPKASLLHQDSESRRLPRS
NSLGAGGKILSQRPPWSLIHRVLPDHPWGTLNPSV
SWGGGGPGTGWGTRPMPHPEGIWGINNQPPGTSWG
NINR
Storage
-20C
Provider Type Product Number
- No reagents -