Antibody data
- Antibody Data
 - Antigen structure
 - References [1]
 - Comments [0]
 - Validations
 - Western blot [1]
 
Submit
Validation data
Reference
Comment
Report error
- Product number
 - ABIN502752 - Provider product page

 - Provider
 - antibodies-online
 - Product name
 - anti-FXYD Domain Containing Ion Transport Regulator 1 (FXYD1) (N-Term) antibody
 - Antibody type
 - Polyclonal
 - Antigen
 - The immunogen for anti-FXYD1 antibody: synthetic peptide directed towards the N terminal of human FXYD1
 - Description
 - Affinity Purified
 - Reactivity
 - Human, Bovine, Canine, Chicken/Avian
 - Host
 - Rabbit
 - Antigen sequence
 ASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSL
QIGGL VIAGILFILG- Epitope
 - N-Term
 - Vial size
 - 50 μg
 - Concentration
 - 1mg/mL
 - Storage
 - -20°C
 - Handling
 - Avoid repeated freeze-thaw cycles.
 
Submitted references		Purification of the human alpha2 Isoform of Na,K-ATPase expressed in Pichia pastoris. Stabilization by lipids and FXYD1.
				
		
	
			Lifshitz Y, Petrovich E, Haviv H, Goldshleger R, Tal DM, Garty H, Karlish SJ
Biochemistry 2007 Dec 25;46(51):14937-50
		Biochemistry 2007 Dec 25;46(51):14937-50
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
		- Submitted by
 - antibodies-online (provider)
 - Main image
 
- Experimental details
 - Image(s): Western Blotting