HPA001196

AMOTL1 antibody from Sigma-Aldrich
JEAP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001196
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001196, RRID:AB_1078147
Product name
Anti-AMOTL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001196
Antibody type
Polyclonal
Antigen
Angiomotin-like protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SPSACYSPSSPVQVLEDSTYFSPDFQLYSGRHETS
ALTVEATSSIREKVVEDPLCNFHSPNFLRISEVEM
RGSEDAAAGTVLQRLIQEQLRYGTPTENMNLLAIQ
HQATGSAGPAHPTNNFSSTENLTQEDPQMVYQSAR
QEPQGQEHQV
Storage
-20C
Provider Type Product Number
- No reagents -