HPA001393

FLOT1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001393
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001393, RRID:AB_1078892
Product name
Anti-FLOT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001393
Antibody type
Polyclonal
Antigen
Flotillin-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVN
MGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDA
RIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAK
AQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTK
QQIEEQR
Storage
-20C
Provider Type Product Number
- No reagents -