Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28425 - Provider product page

- Provider
- Abnova Corporation
- Product name
- SNTB2 polyclonal antibody
- Antibody type
- Polyclonal
- Antigen
- Recombinant protein corresponding to human SNTB2.
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
NRMPILISKIFPGLAADQSRALRLGDAILSVNGTD
LRQATHDQAVQALKRAGKEVLLEVKFIREVTPYIK
KPSLVSDLPWEGAAPQSPSFSGSEDSGSPKHQNST
KDRKIIPLKMCFAARNLSMPDLENRL- Isotype
- IgG
- Vial size
- 100 μl
- Storage
- Store at 4 °C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of lane 1: RT-4, lane 2: U-251 MG, lane 3: A-431 and lane 4: Tonsil using SNTB2 polyclonal antibody (Cat # PAB28425).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of lane 1: NIH-3T3 cell lysateand lane 2: NBT-II cell lysate using SNTB2 polyclonal antibody (Cat # PAB28425).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human prostate with SNTB2 polyclonal antibody (Cat # PAB28425) shows membranous positivity in glandular cells.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)