HPA001394

SNTB2 antibody from Sigma-Aldrich
D16S2531E, EST25263, SNT2B2, SNT3, SNTL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001394
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001394, RRID:AB_1080170
Product name
Anti-SNTB2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001394
Antibody type
Polyclonal
Antigen
beta-2-Syntrophin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NRMPILISKIFPGLAADQSRALRLGDAILSVNGTD
LRQATHDQAVQALKRAGKEVLLEVKFIREVTPYIK
KPSLVSDLPWEGAAPQSPSFSGSEDSGSPKHQNST
KDRKIIPLKMCFAARNLSMPDLENRL
Storage
-20C
Provider Type Product Number
- No reagents -