ABIN503014

TRMT61A antibody from antibodies-online
C14orf172, FLJ40452, GCD14, Gcd14p, hTRM61

Antibody data

Product number
ABIN503014
Provider
antibodies-online
Product name
anti-tRNA Methyltransferase 61 Homolog A (S. Cerevisiae) (TRMT61A) (N-Term) antibody
Provider product page
antibodies-online - ABIN503014
Antibody type
Polyclonal
Antigen
The immunogen for anti-C14orf172 antibody: synthetic peptide directed towards the N terminal of human C14orf172
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Zebrafish
Host
Rabbit
Antigen sequence
MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQ
TQTRH GVLRHSVDLI
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -