HPA002996

ELP2 antibody from Sigma-Aldrich
FLJ10879, STATIP1, StIP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002996
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002996, RRID:AB_1857552
Product name
Anti-STATIP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002996
Antibody type
Polyclonal
Antigen
Elongator complex protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ECDSTDDCIEHNIGPCSSVLDVGGAVTAVSVCPVL
HPSQRYVVAVGLECGKICLYTWKKTDQVPEINDWT
HCVETSQSQSHTLAIRKLCWKNCSGKTEQKEAEGA
EWLHFASCGEDHTVKIHRVNKCA
Storage
-20C
Provider Type Product Number
- No reagents -