Antibody data

Product number
H00006139-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006139-M01, RRID:AB_1580254
Product name
RPL17 monoclonal antibody (M01), clone 3G11
Provider product page
Abnova Corporation - H00006139-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant RPL17.
Antigen sequence
MVRYSLDPEDPTKSCKSRGSNLRVHFKNTRETAQA
IKGMHIRKATKYLKDVTLQKQCVPFRRYNGGVGRC
AQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELK
GLDVDSLVIEHIQVNKAPKVRRRTYRAHGRINPYM
SSPCHIEMILTEKEQIVPKPEEEVAQKKKISQKKL
KKQKLMARE
Isotype
IgG
Antibody clone number
3G11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -