HPA017930

ULK4 antibody from Sigma-Aldrich
FAM7C1, FLJ20574, REC01035
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017930
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017930, RRID:AB_1858615
Product name
Anti-ULK4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017930
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase ULK4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTREIKHKNIVTFHEWYETSNHLWLVVELCTGGSL
KTVIAQDENLPEDVVREFGIDLISGLHHLHKLGIL
FCDISPRKILLEGPGTLKFSNFCLAKVEGENLEEF
FALVAAEEGGGDNGENVLKKSMKSRVKGSPVYTAP
EV
Storage
-20C
Provider Type Product Number
- No reagents -