HPA018817

TXNDC2 antibody from Sigma-Aldrich
SPTRX1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018817
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018817, RRID:AB_2241329
Product name
Anti-TXNDC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018817
Antibody type
Polyclonal
Antigen
Thioredoxin domain-containing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KELGMESVKAGASGKPEMRLGTQEETSEGDANESS
LLVLSSNVPLLALEFLEIAQAKEKAFLPMVSHTFH
MRTEESDASQEGDDLPKSSANTSHPKQDDSPKSSE
ETIQP
Storage
-20C
Provider Type Product Number
- No reagents -