HPA051740

KDM4E antibody from Atlas Antibodies
JMJD2E, KDM4DL, KDM5E
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA051740
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA051740, RRID:AB_2681586
Product name
Anti-KDM4E
Provider product page
Atlas Antibodies - HPA051740
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LRLLPNLTAQCPTQPVSSGHCYNPKGCGTDAVPGS
AFQSSAYHTQTQSLTLGMSARVLLPSTGSWGSGRG
R
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -