Antibody data

Product number
H00000467-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000467-M04, RRID:AB_534783
Product name
ATF3 monoclonal antibody (M04), clone 8G5
Provider product page
Abnova Corporation - H00000467-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant ATF3.
Antigen sequence
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFA
NLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDR
PLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRN
KKKEKTECLQKESEKLESVNAELKAQIEELKNEKQ
HLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIK
EGTLQS
Isotype
IgG
Antibody clone number
8G5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -