Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000467-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000467-M01, RRID:AB_534782
- Product name
- ATF3 monoclonal antibody (M01), clone 6B8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant ATF3.
- Antigen sequence
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFA
NLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDR
PLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRN
KKKEKTECLQKESEKLESVNAELKAQIEELKNEKQ
HLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIK
EGTLQS- Isotype
- IgG
- Antibody clone number
- 6B8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Transcriptional regulators of the ΔNp63: their role in limbal epithelial cell proliferation.
Energy restriction-mimetic agents induce apoptosis in prostate cancer cells in part through epigenetic activation of KLF6 tumor suppressor gene expression.
Steroids and extracellular signal-regulated kinase 1/2 activity suppress activating transcription factor 3 expression in patients with severe asthma.
Hsueh YJ, Kuo PC, Chen JK
Journal of cellular physiology 2013 Mar;228(3):536-46
Journal of cellular physiology 2013 Mar;228(3):536-46
Energy restriction-mimetic agents induce apoptosis in prostate cancer cells in part through epigenetic activation of KLF6 tumor suppressor gene expression.
Chen CH, Huang PH, Chu PC, Chen MC, Chou CC, Wang D, Kulp SK, Teng CM, Wang Q, Chen CS
The Journal of biological chemistry 2011 Mar 25;286(12):9968-76
The Journal of biological chemistry 2011 Mar 25;286(12):9968-76
Steroids and extracellular signal-regulated kinase 1/2 activity suppress activating transcription factor 3 expression in patients with severe asthma.
Roussel L, Robins S, Schachter A, Bérubé J, Hamid Q, Rousseau S
The Journal of allergy and clinical immunology 2011 Jun;127(6):1632-4
The Journal of allergy and clinical immunology 2011 Jun;127(6):1632-4
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ATF3 expression in transfected 293T cell line by ATF3 monoclonal antibody (M01), clone 6B8.Lane 1: ATF3 transfected lysate(20.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ATF3 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol