HPA001562

ATF3 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001562
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001562, RRID:AB_1078233
Product name
Anti-ATF3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001562
Antibody type
Polyclonal
Antigen
Cyclic AMP-dependent transcription factor ATF-3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFA
NLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDR
PLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRN
KKKEKTEC
Storage
-20C
Provider Type Product Number
- No reagents -