PAB30001

CLDN17 antibody from Abnova Corporation
MGC126552, MGC126554

Antibody data

Product number
PAB30001
Provider
Abnova Corporation
Product name
CLDN17 polyclonal antibody
Provider product page
Abnova Corporation - PAB30001
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against synthetic peptide of human CLDN17.
Antigen sequence
KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPV
SWTANIIIRDFYNPA
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -