Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182849 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Claudin 17 (CLDN17) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CLDN17 antibody: synthetic peptide directed towards the middle region of human CLDN17
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPV
SWTAN IIIRDFYNPA- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Claudin-based permeability barriers in taste buds.
CLDN23 gene, frequently down-regulated in intestinal-type gastric cancer, is a novel member of CLAUDIN gene family.
Michlig S, Damak S, Le Coutre J
The Journal of comparative neurology 2007 Jun 20;502(6):1003-11
The Journal of comparative neurology 2007 Jun 20;502(6):1003-11
CLDN23 gene, frequently down-regulated in intestinal-type gastric cancer, is a novel member of CLAUDIN gene family.
Katoh M, Katoh M
International journal of molecular medicine 2003 Jun;11(6):683-9
International journal of molecular medicine 2003 Jun;11(6):683-9
No comments: Submit comment
No validations: Submit validation data