ABIN1106719

CLDN17 antibody from antibodies-online
MGC126552, MGC126554

Antibody data

Product number
ABIN1106719
Provider
antibodies-online
Product name
anti-Claudin 17 (CLDN17) (Middle Region) antibody
Provider product page
antibodies-online - ABIN1106719
Antibody type
Polyclonal
Antigen
The immunogen for anti-CLDN17 antibody: synthetic peptide directed towards the middle region of human CLDN17
Description
Purified using Protein A affinity column
Reactivity
Human, Mouse, Rat, Bovine, Canine, Porcine
Host
Rabbit
Antigen sequence
KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPV
SWTANIIIRDFYNPA
Epitope
Middle Region
Vial size
0.1 mg
Storage
Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
Handling
Avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -