HPA002018

CD36 antibody from Sigma-Aldrich
FAT, GP3B, GP4, GPIV, SCARB3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002018
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002018, RRID:AB_1078464
Product name
Anti-CD36 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002018
Antibody type
Polyclonal
Antigen
Platelet glycoprotein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEV
MMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNT
VSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAAS
HIYQNQFVQMILNSLINKSKSSMFQVRTLREL
Storage
-20C
Provider Type Product Number
- No reagents -