H00051339-M03

DACT1 antibody from Abnova Corporation
DAPPER, DAPPER1, FRODO, HDPR1, THYEX3

Antibody data

Product number
H00051339-M03
Provider
Abnova Corporation
Product name
DACT1 monoclonal antibody (M03), clone 5D8
Provider product page
Abnova Corporation - H00051339-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant DACT1.
Antigen sequence
VVDTSEDEQSNYTTNCFGDSESSVSEGEFVGESTT
TSDSEESGGLIWSQFVQTLPIQTVTAPDLHNHPAK
TFVKIKASHNLKKKILRFRSGSLKLMTTV
Isotype
IgG
Antibody clone number
5D8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.