Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB15692 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB15692, RRID:AB_10687065
- Product name
- Kidins220 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against partial recombinant Kidins220.
- Antigen sequence
SDSGVRSNESSPNHSLHNEAADDSQLEKANLIELE
DEGHSGKRGMPHSLSGLQDPVIARMSICSEDKKSP
SECSLIASSPEESWPSCQKAYNLNRTPSTVTLNNN
TAPTNRANQNFDEIEGVRETSQVILRPGPSPNPTA
VQNENLKSMAHKRSQRSSYTRLSKDASELHAASSD
STGFGEERESIL- Storage
- Store at -20°C.Aliquot to avoid repeated freezing and thawing.
Submitted references Kidins220/ARMS associates with B-Raf and the TCR, promoting sustained Erk signaling in T cells.
A comprehensive approach for establishment of the platform to analyze functions of KIAA proteins II: public release of inaugural version of InGaP database containing gene/protein expression profiles for 127 mouse KIAA genes/proteins.
High-throughput production of recombinant antigens for mouse KIAA proteins in Escherichia coli: computational allocation of possible antigenic regions, and construction of expression plasmids of glutathione-S-transferase-fused antigens by an in vitro recombination-assisted method.
Identification and cloning of Kidins220, a novel neuronal substrate of protein kinase D.
Deswal S, Meyer A, Fiala GJ, Eisenhardt AE, Schmitt LC, Salek M, Brummer T, Acuto O, Schamel WW
Journal of immunology (Baltimore, Md. : 1950) 2013 Mar 1;190(5):1927-35
Journal of immunology (Baltimore, Md. : 1950) 2013 Mar 1;190(5):1927-35
A comprehensive approach for establishment of the platform to analyze functions of KIAA proteins II: public release of inaugural version of InGaP database containing gene/protein expression profiles for 127 mouse KIAA genes/proteins.
Koga H, Yuasa S, Nagase T, Shimada K, Nagano M, Imai K, Ohara R, Nakajima D, Murakami M, Kawai M, Miki F, Magae J, Inamoto S, Okazaki N, Ohara O
DNA research : an international journal for rapid publication of reports on genes and genomes 2004 Aug 31;11(4):293-304
DNA research : an international journal for rapid publication of reports on genes and genomes 2004 Aug 31;11(4):293-304
High-throughput production of recombinant antigens for mouse KIAA proteins in Escherichia coli: computational allocation of possible antigenic regions, and construction of expression plasmids of glutathione-S-transferase-fused antigens by an in vitro recombination-assisted method.
Hara Y, Shimada K, Kohga H, Ohara O, Koga H
DNA research : an international journal for rapid publication of reports on genes and genomes 2003 Jun 30;10(3):129-36
DNA research : an international journal for rapid publication of reports on genes and genomes 2003 Jun 30;10(3):129-36
Identification and cloning of Kidins220, a novel neuronal substrate of protein kinase D.
Iglesias T, Cabrera-Poch N, Mitchell MP, Naven TJ, Rozengurt E, Schiavo G
The Journal of biological chemistry 2000 Dec 22;275(51):40048-56
The Journal of biological chemistry 2000 Dec 22;275(51):40048-56
No comments: Submit comment
No validations: Submit validation data