HPA014790

KIDINS220 antibody from Sigma-Aldrich
ARMS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014790
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014790, RRID:AB_1852460
Product name
Anti-KIDINS220 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014790
Antibody type
Polyclonal
Antigen
Ankyrin repeat-rich membrane spanning protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EPLLEIDGDIRNFEVFLSSRTPVLVARDVKVFLPC
TVNLDPKLREIIADVRAAREQISIGGLAYPPLPLH
EGPPRAPSGYSQPPSVCSSTSFNGPFAGGVVS
Storage
-20C
Provider Type Product Number
- No reagents -