HPA017945

KRTAP23-1 antibody from Sigma-Aldrich
KAP23.1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017945
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017945, RRID:AB_1852641
Product name
Anti-KRTAP23 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017945
Antibody type
Polyclonal
Antigen
Keratin-associated protein 23-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MSYNCCCGNFSSHSCEGYLCYSGYSRGGSSYPSNL
VYSTEPLISQHLPAGFLSLQGLSGDLLGNP
Storage
-20C
Provider Type Product Number
- No reagents -