HPA023252

NECAB1 antibody from Sigma-Aldrich
EFCBP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023252
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023252, RRID:AB_1848013
Product name
Anti-NECAB1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023252
Antibody type
Polyclonal
Antigen
N-terminal EF-hand calcium-binding protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PGLLEEDNQWMTQINRLQKLIDRLEKKDLKLEPPE
EEIIEGNTKSHIMLVQRQMSVIEEDLEEFQLALKH
YVE
Storage
-20C
Provider Type Product Number
- No reagents -