HPA001862

IRF9 antibody from Sigma-Aldrich
ISGF3G
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001862
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001862, RRID:AB_1079153
Product name
Anti-IRF9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001862
Antibody type
Polyclonal
Antigen
Interferon regulatory factor 9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSD
IGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLP
PEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPS
GSESSMEQVLFPKPGPLEPTQRLLSQLER
Storage
-20C
Provider Type Product Number
- No reagents -