HPA019534

KRTAP15-1 antibody from MilliporeSigma / Merck KGaA
KAP15.1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019534
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA019534, RRID:AB_1852640
Product name
Anti-KRTAP15-1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA019534
Antibody type
Polyclonal
Antigen
Keratin-associated protein 15-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSCCFGSYLRYPVSTYNLFYPSNAIYSPNTCQLGS
SLYNGCQETYCEPTSCQTSCTLARSYQ
Storage
-20C
Provider Type Product Number
- No reagents -