H00005580-M09A

PRKCD antibody from Abnova Corporation
No application information provided.

Antibody data

Product number
H00005580-M09A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005580-M09A, RRID:AB_1579135
Product name
PRKCD monoclonal antibody (M09A), clone 8H1
Provider product page
Abnova Corporation - H00005580-M09A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PRKCD.
Antigen sequence
DILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLL
EKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSY
SDKNLIDSMDQSAFAGFSFVNPKFEHLLED
Isotype
IgG
Antibody clone number
8H1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -