HPA001890

PRKCD antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001890
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001890, RRID:AB_1079628
Product name
Anti-PRKCD antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001890
Antibody type
Polyclonal
Antigen
Protein kinase Cdelta-type recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ANLCGINQKLLAEALNQVTQRASRRSDSASSEPVG
IYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCNI
NNFIFHKVLGKGSFGKVLLGELKGRGEYFAIKALK
KDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICT
FQTKDH
Storage
-20C
Provider Type Product Number
- No reagents -