HPA001396

FLOT2 antibody from Atlas Antibodies
ECS-1, ECS1, ESA, ESA1, M17S1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001396
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001396, RRID:AB_1078894
Product name
Anti-FLOT2
Provider product page
Atlas Antibodies - HPA001396
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEV
NIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRK
KQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQI
AEGEKVKQVLLAQAEAEKIRK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -