HPA001396

FLOT2 antibody from Sigma-Aldrich
ECS-1, ECS1, ESA, ESA1, M17S1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001396
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001396, RRID:AB_1078894
Product name
Anti-FLOT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001396
Antibody type
Polyclonal
Antigen
Flotillin-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEV
NIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRK
KQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQI
AEGEKVKQVLLAQAEAEKIRK
Storage
-20C
Provider Type Product Number
- No reagents -