H00001012-M01A

CDH13 antibody from Abnova Corporation
CDHH
No application information provided.

Antibody data

Product number
H00001012-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001012-M01A, RRID:AB_1136910
Product name
CDH13 monoclonal antibody (M01A), clone 3H4
Provider product page
Abnova Corporation - H00001012-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant CDH13.
Antigen sequence
MQPRTPLVLCVLLSQVLLLTSAEDLDCTPGFQQKV
FHINQPAEFIEDQSILNLTFSDCKGNDKLRYEVSS
PYFKVNSDGGLVALRNITAVGKTLFVHARTPHAED
MAELVIVGGKDIQGSLQDIFKFARTSPVPRQKRSI
VVSPILIPENQRQPFPRDVGKVVDSDRPERSKFRL
TGKGVDQEPKGIFRINENTGSVSMTRTLDREVIAV
YQLFVETTDVNGKTLEGPVPLEVIVIDQNDNRPIF
REGPYIGHVMEGSPTGTTVMRMTAFDADDPATDNA
LLRYNIRRQTPDKPSPNMFYIDPEKGDIVTVVSPA
LLDRETLENPKYELIIEAQDMAGLDVGLTGTATAT
IMIDDKNDHSPKFTKKEFQATVEEGAVGVIVNLTV
EDKDDPATGAWRAAYTIINGNPGQSFEIHTNPQTN
EGMLSVVKPLDYEISAFHTLLIKVENEDPLVPDVS
YGPSSTATVHITVLDVNEGPVFYPDPMMVTRQEDL
SVGSVLLTVNATDPDSLQHQTIRYSVYKDPAGWLN
INPINGTVDTTAVLDRESTFVDNSVYTALFLAIDS
GNPPATGTGTLLITLEDVNDNAPFIYPTVAEVCDD
AKNLSVVILGASDKDLHPNTDPFKFEIHKQAVPDK
VWKISKINNTHALVSLLQNLNKANYNLPIMVTDSG
KPPMTNITDLRVQVCSCRNSKVDCNAAGALRFSLP
SVLLLSLFSLACL
Isotype
IgM
Antibody clone number
3H4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -