HPA001380

CDH13 antibody from Sigma-Aldrich
CDHH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001380
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001380, RRID:AB_1078371
Product name
Anti-CDH13 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001380
Antibody type
Polyclonal
Antigen
Cadherin-13 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GTGTLLITLEDVNDNAPFIYPTVAEVCDDAKNLSV
VILGASDKDLHPNTDPFKFEIHKQAVPDKVWKISK
INNTHALVSLLQNLNKANYNLPIMVTDSGKPPMTN
ITDLRVQVCSCRNSKVDCNAAGALRFSLPSVLLLS
LFSLA
Storage
-20C
Provider Type Product Number
- No reagents -