Antibody data

Product number
ABIN1545229
Provider
antibodies-online
Product name
anti-Olfactory Receptor, Family 7, Subfamily A, Member 5 (OR7A5) (C-Term) antibody
Provider product page
antibodies-online - ABIN1545229
Antibody type
Polyclonal
Antigen
The immunogen for Anti-OR7A5 antibody is: synthetic peptide directed towards the C-terminal region of Human OR7A5
Reactivity
Human
Host
Rabbit
Antigen sequence
YLSSAATRNSHSSATASVMYTVVTPMLNPFIYSLR
NKDIK RALGIHLLWG
Epitope
C-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.