Antibody data

Product number
H00112398-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00112398-M01, RRID:AB_1574585
Product name
EGLN2 monoclonal antibody (M01), clone 2G3
Provider product page
Abnova Corporation - H00112398-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant EGLN2.
Antigen sequence
MDSPCQPQPLSQALPQLPGSSSEPLEPEPGRARMG
VESYLPCPLLPSYHCPGVPSEASAGSGTPRATATS
TTASPLRDGFGGQDGGELRPLQSEGAAALVTKGCQ
RLAAQGARPEAPKRKWAEDGGDAPSPSKRPWARQE
NQEAEREGGMSCSCSSGSGEASAGLMEEALPSAPE
RLALDYIVPCMRYYGICVKDSFLGAALGGRVLAEV
EALKRGGRLRDGQLVSQRAIPPRSIRGDQIAWVEG
HEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRT
KAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLN
QNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIF
WSDRRNPHEVKPAYATRYAITVWYFDAKERAAAKD
KYQLASGQKGVQVPVSQPPTPT
Isotype
IgG
Antibody clone number
2G3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -