Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502686 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Keratin Associated Protein 8-1 (KRTAP8-1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KRTAP8-1 antibody: synthetic peptide directed towards the middle region of human KRTAP8-1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
LCDNFPGAVFPGCYWGSYGYPLGYSVGCGYGSTYS
PVGYG FGYGYNGCGA- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Characterization of a first domain of human high glycine-tyrosine and high sulfur keratin-associated protein (KAP) genes on chromosome 21q22.1.
Rogers MA, Langbein L, Winter H, Ehmann C, Praetzel S, Schweizer J
The Journal of biological chemistry 2002 Dec 13;277(50):48993-9002
The Journal of biological chemistry 2002 Dec 13;277(50):48993-9002
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting