HPA024398

RBM12B antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024398
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024398, RRID:AB_1856109
Product name
Anti-RBM12B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024398
Antibody type
Polyclonal
Antigen
RNA-binding protein 12B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NLSLSIDERDLRNFFRGTDLTDEQIRFLYKDENRT
RYAFVMFKTLKDYNTALSLHKTVLQYRPVHIDPIS
RKQMLKFIARYEKK
Storage
-20C
Provider Type Product Number
- No reagents -