HPA002981

CADM3 antibody from Atlas Antibodies
BIgR, FLJ10698, IGSF4B, Necl-1, NECL1, SynCAM3, TSLL1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002981
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002981, RRID:AB_1078916
Product name
Anti-CADM3
Provider product page
Atlas Antibodies - HPA002981
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QLVTSTPHELSISISNVALADEGEYTCSIFTMPVR
TAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQ
SSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTF
TVSSSVTFQVTREDDGASIVCSVNHESLKGADRST
SQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -