HPA002981

CADM3 antibody from Sigma-Aldrich
BIgR, FLJ10698, IGSF4B, Necl-1, NECL1, SynCAM3, TSLL1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002981
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002981, RRID:AB_1078916
Product name
Anti-CADM3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002981
Antibody type
Polyclonal
Antigen
Cell adhesion molecule 3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QLVTSTPHELSISISNVALADEGEYTCSIFTMPVR
TAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQ
SSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTF
TVSSSVTFQVTREDDGASIVCSVNHESLKGADRST
SQ
Storage
-20C
Provider Type Product Number
- No reagents -