HPA023720

antibody from Atlas Antibodies

Targeting: ESRP1 FLJ20171, RBM35A

Immunocytochemistry (Data presented on provider website)

Immunohistochemistry (Data presented on provider website)

Antibody Data

Product number

HPA023720

Provider

Atlas Antibodies

Proper citation

Atlas Antibodies Cat#HPA023720, RRID:AB_1856125

Product name

Anti-ESRP1

Antibody type

Polyclonal

Description

Affinity purified using the PrEST antigen as affinity ligand

Reactivity

Human

Host

Rabbit

Conjugate

Unconjugated

Antigen sequence

QLHVRQILHPEASKKNVLLPECFYSFFDLRKEFKK
CCPGSPDIDKLDVATMTEYLNFEKSSSVSRYGASQ
VEDMGNIILAMISEPYNHRFSDPERVNYKFES


Isotype

IgG

Vial size

100 µl

Storage

Store at +4°C for short term storage. Long time storage is recommended at -20°C.

References

Submitted references

Epithelial splicing regulatory protein 1 and 2 (ESRP1 and ESRP2) upregulation predicts poor prognosis in prostate cancer

Freytag M, Kluth M, Bady E, Hube-Magg C, Makrypidi-Fraune G, Heinzer H, Höflmayer D, Weidemann S, Uhlig R, Huland H, Graefen M, Bernreuther C, Wittmer C, Tsourlakis M, Minner S, Dum D, Hinsch A, Luebke A, Simon R, Sauter G, Schlomm T, Möller K
BMC Cancer 2020;20(1)

---

Cancer Stem-Cell Marker CD44v9-Positive Cells Arise From Helicobacter pylori–Infected CAPZA1-Overexpressing Cells

Tsugawa H, Kato C, Mori H, Matsuzaki J, Kameyama K, Saya H, Hatakeyama M, Suematsu M, Suzuki H
Cellular and Molecular Gastroenterology and Hepatology 2019;8(3):319-334

---

Molecular Evolution of Early-Onset Prostate Cancer Identifies Molecular Risk Markers and Clinical Trajectories

Gerhauser C, Favero F, Risch T, Simon R, Feuerbach L, Assenov Y, Heckmann D, Sidiropoulos N, Waszak S, Hübschmann D, Urbanucci A, Girma E, Kuryshev V, Klimczak L, Saini N, Stütz A, Weichenhan D, Böttcher L, Toth R, Hendriksen J, Koop C, Lutsik P, Matzk S, Warnatz H, Amstislavskiy V, Feuerstein C, Raeder B, Bogatyrova O, Schmitz E, Hube-Magg C, Kluth M, Huland H, Graefen M, Lawerenz C, Henry G, Yamaguchi T, Malewska A, Meiners J, Schilling D, Reisinger E, Eils R, Schlesner M, Strand D, Bristow R, Boutros P, von Kalle C, Gordenin D, Sültmann H, Brors B, Sauter G, Plass C, Yaspo M, Korbel J, Schlomm T, Weischenfeldt J
Cancer Cell 2018;34(6):996-1011.e8

---

Esrp1 is a marker of mouse fetal germ cells and differentially expressed during spermatogenesis

Singh S, Saeidi S, Shapouri F, de Iongh R, Casagranda F, Sutherland J, Western P, McLaughlin E, Familari M, Hime G
PLOS ONE 2018;13(1):e0190925

---

ESRP1 is overexpressed in ovarian cancer and promotes switching from mesenchymal to epithelial phenotype in ovarian cancer cellsThis article has been corrected since Advance Online Publication and an erratum is also printed in this issue

Jeong H, Han J, Lee S, Park H, Lee H, Choi J, Lee Y, Choi Y, Shin Y, Kwon M
Oncogenesis 2017;6(10):e389-e389

---

Splicing factor ratio as an index of epithelial-mesenchymal transition and tumor aggressiveness in breast cancer

Fici P, Gallerani G, Morel A, Mercatali L, Ibrahim T, Scarpi E, Amadori D, Puisieux A, Rigaud M, Fabbri F
Oncotarget 2016;8(2):2423-2436

---

Comparable roles of CD44v8-10 and CD44s in the development of bone metastases in a mouse model.

Hiraga T, Nakamura H
Oncology letters 2016 Oct;12(4):2962-2969

---

Epithelial Splicing Regulatory Proteins 1 (ESRP1) and 2 (ESRP2) Suppress Cancer Cell Motility via Different Mechanisms

Ishii H, Saitoh M, Sakamoto K, Kondo T, Katoh R, Tanaka S, Motizuki M, Masuyama K, Miyazawa K
Journal of Biological Chemistry 2014;289(40):27386-27399