HPA023719

ESRP1 antibody from Sigma-Aldrich
FLJ20171, RBM35A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023719
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023719, RRID:AB_1856124
Product name
Anti-ESRP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023719
Antibody type
Polyclonal
Antigen
RNA-binding protein 35A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PGSPNSLGYFPTAANLSGVPPQPGTVVRMQGLAYN
TGVKEILNFFQGYQYATEDGLIHTNDQARTLPKEW
VCI
Storage
-20C
Provider Type Product Number
- No reagents -