H00054490-B01P

UGT2B28 antibody from Abnova Corporation
Western blot
Data presented on provider website

Antibody data

Product number
H00054490-B01P
Provider
Abnova Corporation
Product name
UGT2B28 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00054490-B01P
Antibody type
Polyclonal
Antigen
UGT2B28 (AAI56173.1, 1 a.a. ~ 529 a.a) full-length human protein.
Reactivity
Human
Host
Mouse
Antigen sequence
MALKWTSVLLLIHLGCYFSSGSCGKVLVWTGEYSH
WMNMKTILKELVQRGHEVTVLASSASILFDPNDAF
TLKLEVYPTSLTKTEFENIIMQQVKRWSDIQKDSF
WLYFSQEQEILWEFHDIFRNFCKDVVSNKKVMKKL
QESRFDIIFADAFFPCGELLAALLNIPFVYSLCFT
PGYTIERHSGGLIFPPSYIPVVMSKLSDQMTFMER
VKNMIYVLYFDFWFQMCDMKKWDQFYSEVLGRPTT
LFETMGKADIWLMRNSWSFQFPHPFLPNIDFVGGL
HCKPAKPLPKEMEEFVQSSGENGVVVFSLGSVISN
MTAERANVIATALAKIPQKVLWRFDGNKPDALGLN
TRLYKWIPQNDLLGLPKTRAFITHGGANGIYEAIY
HGIPMVGIPLFWDQPDNIAHMKAKGAAVRLDFHTM
SSTDLLNALKTVINDPSYKENVMKLSIIQHDQPVK
PLHRAVFWIEFVMCHKGAKHLRVAARDLTWFQYHS
LDVIGFLLACVATVIFVVTKFCLFCFWKFARKGKK
GKRD
Vial size
50 µg
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.