HPA001397

CNTN2 antibody from Sigma-Aldrich
AXT, TAG-1, TAX, TAX1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001397
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001397, RRID:AB_1847146
Product name
Anti-CNTN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001397
Antibody type
Polyclonal
Antigen
Contactin-2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PASPSANATTMKPPPRRPPGNISWTFSSSSLSIKW
DPVVPFRNESAVTGYKMLYQNDLHLTPTLHLTGKN
WIEIPVPEDIGHALVQIRTTGPGGDGIPAEVHIVR
NGGTSMMVENMAVRPAPHPGTVISHSVAMLIL
Storage
-20C
Provider Type Product Number
- No reagents -