HPA023654

CEP95 antibody from MilliporeSigma / Merck KGaA
CCDC45, DKFZp667E1824
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023654
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA023654, RRID:AB_2072077
Product name
Anti-CCDC45 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA023654
Antibody type
Polyclonal
Antigen
Coiled-coil domain-containing protein 45 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PPYHPSEPRAPCPIGKEYLHSSHCSPAVNSTGEHT
EFSGDLDDGLFLISKLPKGSKWEVYPAQVQGPRTR
KPPKGKRNENRATASSCNSP
Storage
-20C
Provider Type Product Number
- No reagents -