Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007070-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007070-M01, RRID:AB_913371
- Product name
- THY1 monoclonal antibody (M01), clone 3F9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant THY1.
- Antigen sequence
MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLR
LDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVP
EHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCA
LHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNT
SWLLLLLLSLSLLQATDFMSL- Isotype
- IgG
- Antibody clone number
- 3F9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references CD90 is identified as a candidate marker for cancer stem cells in primary high-grade gliomas using tissue microarrays.
Protein profiling of microdomains purified from renal cell carcinoma and normal kidney tissue samples.
Differential profiling studies of N-linked glycoproteins in glioblastoma cancer stem cells upon treatment with γ-secretase inhibitor.
He J, Liu Y, Zhu T, Zhu J, Dimeco F, Vescovi AL, Heth JA, Muraszko KM, Fan X, Lubman DM
Molecular & cellular proteomics : MCP 2012 Jun;11(6):M111.010744
Molecular & cellular proteomics : MCP 2012 Jun;11(6):M111.010744
Protein profiling of microdomains purified from renal cell carcinoma and normal kidney tissue samples.
Raimondo F, Morosi L, Chinello C, Perego R, Bianchi C, Albo G, Ferrero S, Rocco F, Magni F, Pitto M
Molecular bioSystems 2012 Apr;8(4):1007-16
Molecular bioSystems 2012 Apr;8(4):1007-16
Differential profiling studies of N-linked glycoproteins in glioblastoma cancer stem cells upon treatment with γ-secretase inhibitor.
Dai L, Liu Y, He J, Flack CG, Talsma CE, Crowley JG, Muraszko KM, Fan X, Lubman DM
Proteomics 2011 Oct;11(20):4021-8
Proteomics 2011 Oct;11(20):4021-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- THY1 monoclonal antibody (M01), clone 3F9. Western Blot analysis of THY1 expression in IMR-32.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged THY1 is 3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol